Domain name:
pennygrahamfinancialservices.co.uk
Data validation:
Nominet was not able to match the registrant's name and/or address against a 3rd party source on 05-Oct-2023
Registrar:
Register.com Inc t/a Network Solutions [Tag =
NSI-US]
URL:
http://www.networksolutions.com
Relevant dates:
Registered on: 05-Oct-2023
Expiry date: 05-Oct-2024
Last updated: 05-Oct-2023
Registration status:
Renewal required.
*** This registration has been SUSPENDED. ***
Name servers:
greg.ns.cloudflare.com
pam.ns.cloudflare.com
WHOIS lookup made at 00:56:21 29-Dec-2024
--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2024.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at
https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.