WHOIS: perfectkitchenchinesetakeaway.co.uk
Error for "perfectkitchenchinesetakeaway.co.uk". the WHOIS query quota for 216.73.216.62 has been exceeded and will be replenished in 8277 seconds WHOIS lookup made at 20:30:29 15-Jun-2025 -- This WHOIS information is provided for free by Nominet UK the central registry for .uk domain names. This information and the .uk WHOIS are: Copyright Nominet UK 1996 - 2025. You may not access the .uk WHOIS or use any data from it except as permitted by the terms of use available in full at https://www.nominet.uk/whoisterms, which includes restrictions on: (A) use of the data for advertising, or its repackaging, recompilation, redistribution or reuse (B) obscuring, removing or hiding any or all of this notice and (C) exceeding query rate or volume limits. The data is provided on an 'as-is' basis and may lag behind the register. Access may be withdrawn or restricted at any time.


The WHOIS is being replaced by the Registration Data Access Protocol (RDAP).
This .uk WHOIS client is made by webber.domains